Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DAD1 (Defender against cell death 1) Full Length (CAT#: MPC4065K) Made to Order

This product is a made-to-order Human DAD1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DAD1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGT
    FPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFA
    STILHLVVMNFVG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • DAD1
  • Full Name
  • Defender against cell death 1
  • Introduction
  • DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes.
  • Alternative Names
  • DAD1; OST2; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; DAD-1; oligosaccharyl transferase subunit DAD1; oligosaccharyltransferase 2 homolog; oligosaccharyltransferase subunit 2 (non-catalytic); Defender against cell death 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us