Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DDR2 (Discoidin domain receptor tyrosine kinase 2) Expressed in NS0 for Antibody Discovery, Partial (24-399aa) (CAT#: MPX0324K)

This product is a 43.3 kDa Human DDR2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DDR2
  • Protein Length
  • Partial (24-399aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 43.3 kDa
  • TMD
  • 1
  • Sequence
  • QVNPAICRYPLGMSGGQIPDEDITASS
    QWSESTAAKYGRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLV
    GTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDI
    FLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQ
    QFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHV
    WPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
    EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY
    HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTR

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • DDR2
  • Full Name
  • Discoidin domain receptor tyrosine kinase 2
  • Introduction
  • This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia.
  • Alternative Names
  • DDR2; TKT; WRCN; MIG20a; NTRKR3; TYRO10; discoidin domain-containing receptor 2; CD167 antigen-like family member B; cell migration-inducing protein 20; discoidin domain receptor 2; discoidin domain receptor family, member 2; discoidin domain-containing receptor tyrosine kinase 2; hydroxyaryl-protein kinase; migration-inducing gene 16 protein; neurotrophic tyrosine kinase receptor related 3; receptor protein-tyrosine kinase TKT; tyrosine-protein kinase TYRO10; Discoidin domain receptor tyrosine kinase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us