Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DGAT2 (Diacylglycerol O-acyltransferase 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1761K)

This product is a Human DGAT2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DGAT2
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 2
  • Sequence
  • MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • DGAT2
  • Full Name
  • Diacylglycerol O-acyltransferase 2
  • Introduction
  • This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • DGAT2; ARAT; HMFN1045; GS1999FULL; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; diglyceride acyltransferase 2; Diacylglycerol O-acyltransferase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us