Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human DNAJC15 (DnaJ heat shock protein family (Hsp40) member C15) Full Length (CAT#: MPC4323K) Made to Order

This product is a made-to-order Human DNAJC15 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DNAJC15
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAAL
    AFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLI
    LGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • DNAJC15
  • Full Name
  • DnaJ heat shock protein family (Hsp40) member C15
  • Alternative Names
  • DNAJC15; MCJ; HSD18; DNAJD1; dnaJ homolog subfamily C member 15; DNAJ domain-containing; DnaJ (Hsp40) homolog, subfamily C, member 15; DnaJ (Hsp40) homolog, subfamily D, member 1; cell growth-inhibiting gene 22 protein; methylation-controlled J protein; DnaJ heat shock protein family (Hsp40) member C15

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us