Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EBAG9 (Estrogen receptor binding site associated antigen 9) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (28-213aa) (CAT#: MPX4499K)

This product is a 37.2kDa Human EBAG9 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EBAG9
  • Protein Length
  • Partial (28-213aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 37.2kDa
  • TMD
  • 1
  • Sequence
  • RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • EBAG9
  • Full Name
  • Estrogen receptor binding site associated antigen 9
  • Introduction
  • This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10.
  • Alternative Names
  • EBAG9; EB9; PDAF; receptor-binding cancer antigen expressed on SiSo cells; cancer-associated surface antigen RCAS1; estrogen receptor-binding fragment-associated gene 9 protein; Estrogen receptor binding site associated antigen 9

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us