Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EFNB3 (Ephrin B3) Expressed in Baculovirus/Insect expression system for Antibody Discovery, Partial (28-224aa) (CAT#: MPX0200K)

This product is a 49.2 kDa Human EFNB3 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EFNB3
  • Protein Length
  • Partial (28-224aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 49.2 kDa
  • TMD
  • 1
  • Sequence
  • LSLEPVYWNSANKRFQAEGGYVL
    YPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNL
    LLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLES
    LQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGK
    ENLPGDPTSNATSRGAEGPLPPPS

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • hIgG1 Fc and 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL with sterile PBS.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with BSA as a carrier protein.

Target

  • Target Protein
  • EFNB3
  • Full Name
  • Ephrin B3
  • Introduction
  • EFNB3, a member of the ephrin gene family, is important in brain development as well as in its maintenance. Moreover, since levels of EFNB3 expression were particularly high in several forebrain subregions compared to other brain subregions, it may play a pivotal role in forebrain function. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH Receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
  • Alternative Names
  • EFNB3; EFL6; EPLG8; LERK8; ephrin-B3; EPH-related receptor transmembrane ligand ELK-L3; eph-related receptor tyrosine kinase ligand 8; Ephrin B3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us