Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ELOVL3 (ELOVL fatty acid elongase 3) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2350K)

This product is a Human ELOVL3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ELOVL3
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 7
  • Sequence
  • MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAIMYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFFCQTYIRPKVKAKTKSQ

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ELOVL3
  • Full Name
  • ELOVL fatty acid elongase 3
  • Introduction
  • This gene encodes a protein that belongs to the GNS1/SUR4 family. Members of this family play a role in elongation of long chain fatty acids to provide precursors for synthesis of sphingolipids and ceramides.
  • Alternative Names
  • ELOVL3; CIG30; CIG-30; elongation of very long chain fatty acids protein 3; 3-keto acyl-CoA synthase ELOVL3; ELOVL FA elongase 3; cold-inducible glycoprotein of 30 kDa; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3; very long chain 3-ketoacyl-CoA synthase 3; very long chain 3-oxoacyl-CoA synthase 3; ELOVL fatty acid elongase 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us