Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ELOVL5 (ELOVL fatty acid elongase 5) Full Length (CAT#: MPC4262K) Made to Order

This product is a made-to-order Human ELOVL5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ELOVL5
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 7
  • Sequence
  • MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGP
    KYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTR
    TAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASM
    LNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKK
    YITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFY
    IQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • ELOVL5
  • Full Name
  • ELOVL fatty acid elongase 5
  • Introduction
  • This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38). Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • ELOVL5; HELO1; SCA38; dJ483K16.1; elongation of very long chain fatty acids protein 5; 3-keto acyl-CoA synthase ELOVL5; ELOVL FA elongase 5; ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); fatty acid elongase 1; homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2; spinocerebellar ataxia 38; very long chain 3-ketoacyl-CoA synthase 5; very long chain 3-oxoacyl-CoA synthase 5; ELOVL fatty acid elongase 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us