Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MMD (Monocyte to macrophage differentiation associated) Full Length (CAT#: MPC2636K) Made to Order

This product is a made-to-order Human MMD membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MMD
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 7
  • Sequence
  • MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLH
    RLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCD
    RMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKY
    KVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGI
    IPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MMD
  • Full Name
  • Monocyte to macrophage differentiation associated
  • Introduction
  • This protein is expressed by in vitro differentiated macrophages but not freshly isolated monocytes. Although sequence analysis identifies seven potential transmembrane domains, this protein has little homology to G-protein receptors and it has not been positively identified as a receptor. A suggested alternative function is that of an ion channel protein in maturing macrophages.
  • Alternative Names
  • MMD; MMA; MMD1; PAQR11; macrophage maturation-associated; monocyte to macrophage differentiation protein; progestin and adipoQ receptor family member 11; progestin and adipoQ receptor family member XI; Monocyte to macrophage differentiation associated

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us