Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ELOVL6 (ELOVL fatty acid elongase 6) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2902K)

This product is a Human ELOVL6 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ELOVL6
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 7
  • Sequence
  • MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ELOVL6
  • Full Name
  • ELOVL fatty acid elongase 6
  • Introduction
  • Fatty acid elongases (EC 6.2.1.3), such as ELOVL6, use malonyl-CoA as a 2-carbon donor in the first and rate-limiting step of fatty acid elongation.
  • Alternative Names
  • ELOVL6; FAE; LCE; FACE; elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase ELOVL6; ELOVL FA elongase 6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); fatty acid elongase 2; fatty acyl-CoA elongase; hELO2; long-chain fatty-acyl elongase; very long chain 3-ketoacyl-CoA synthase 6; very long chain 3-oxoacyl-CoA synthase 6; ELOVL fatty acid elongase 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us