Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ENTPD5 (Ectonucleoside triphosphate diphosphohydrolase 5 (inactive)) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3901K)

This product is a Human ENTPD5 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ENTPD5
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Sequence
  • MATSWGTVFFMLVVSCVCSAVSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ENTPD5
  • Full Name
  • Ectonucleoside triphosphate diphosphohydrolase 5 (inactive)
  • Introduction
  • The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases.
  • Alternative Names
  • ENTPD5; PCPH; CD39L4; NTPDase-5; CD39 antigen-like 4; CD39-like 4; ER-UDPase; GDPase ENTPD5; NTPDase 5; Pcph proto-oncogene protein; UDPase ENTPD5; guanosine-diphosphatase ENTPD5; nucleoside diphosphatase; proto-oncogene CPH; uridine-diphosphatase ENTPD5; Ectonucleoside triphosphate diphosphohydrolase 5 (inactive)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us