Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EPCAM (Epithelial cell adhesion molecule) with C-His tag for Antibody Discovery (CAT#: MP1316J)

This product is a 28.4 kDa Human EPCAM membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EPCAM
  • Protein Length
  • Partial (24-265aa)
  • Protein Class
  • ES Cell Differentiation/IPS, Transmembrane
  • Molecular Weight
  • 28.4 kDa
  • TMD
  • 1
  • Sequence
  • QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK
    AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR
    TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA
    DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • C-His
  • Endotoxin
  • <0. 1 EU/µg
  • Purity
  • >95% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 0.2 µM filtered solution of 20mM Phosphate buffer, 150mM NaCl, pH 7.2

Target

  • Target Protein
  • EPCAM
  • Full Name
  • Epithelial cell adhesion molecule
  • Introduction
  • This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
  • Alternative Names
  • ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1; adenocarcinoma-associated antigen; cell surface glycoprotein Trop-1; epithelial glycoprotein 314

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us