Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PIGF (Phosphatidylinositol glycan anchor biosynthesis class F) Full Length (CAT#: MPC4331K) Made to Order

This product is a made-to-order Human PIGF membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PIGF
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 6
  • Sequence
  • MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
    VTAVNLVLYLVVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVL
    YGAPLIELALETFLFAVILSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSI
    WENSLQITTISSFVGAWLGALPIPLDWERPWQVWPISCTLGATFGYVAGL
    VISPLWIYWNRKQLTYKNN

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • PIGF
  • Full Name
  • Phosphatidylinositol glycan anchor biosynthesis class F
  • Introduction
  • This gene encodes a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.
  • Alternative Names
  • PIGF; OORS; phosphatidylinositol-glycan biosynthesis class F protein; GPI11 homolog; PIG-F; Phosphatidylinositol glycan anchor biosynthesis class F

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us