Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human EPCAM (Epithelial cell adhesion molecule) Expressed in HEK293 for Antibody Discovery, Partial (24-265aa) (CAT#: MPX0586K)

This product is a 28 kDa Human EPCAM membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EPCAM
  • Protein Length
  • Partial (24-265aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 28 kDa
  • TMD
  • 1
  • Sequence
  • QEECVCENYKLAVNCFVNNNRQCQCTS
    VGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCD
    ESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKH
    KAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSS
    QKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIY
    YVDEKAPEFSMQGLK

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • EPCAM
  • Full Name
  • Epithelial cell adhesion molecule
  • Introduction
  • This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
  • Alternative Names
  • EPCAM; ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1; adenocarcinoma-associated antigen; cell surface glycoprotein Trop-1; epithelial glycoprotein 314; human epithelial glycoprotein-2; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); trophoblast cell surface antigen 1; tumor-associated calcium signal transducer 1; Epithelial cell adhesion molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us