Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ERG28 (Ergosterol biosynthesis 28 homolog expressed in in vitro wheat germ expression system) for Antibody Discovery (CAT#: MP0129X)

This product is a 42.3 kDa Human ERG28 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ERG28
  • Protein Length
  • Full-length
  • Molecular Weight
  • 42.3 kDa
  • TMD
  • 4
  • Sequence
  • MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILGMLVGLRYLEVEPVSRQKKRN

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • ERG28
  • Full Name
  • Ergosterol biosynthesis 28 homolog
  • Introduction
  • ERG28 (Ergosterol Biosynthesis 28 Homolog) is a Protein Coding gene. Diseases associated with ERG28 include Neuronal Ceroid Lipofuscinosis and Ceroid Lipofuscinosis, Neuronal, 8, Northern Epilepsy Variant
  • Alternative Names
  • ERG28; NET51; hypothetical protein LOC11161

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us