Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ESAM (Endothelial cell adhesion molecule) expressed in E. coli for Antibody Discovery (CAT#: MP0015Q)

This product is a 27.80 kDa Human ESAM membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ESAM
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 27.80 kDa
  • TMD
  • 1
  • Sequence
  • ISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGARSHHHHHH

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Endotoxin
  • < 0.1 ng/µg
  • Purity
  • >95% by SDS-PAGE and silver stain
  • Buffer
  • PBS

Target

  • Target Protein
  • ESAM
  • Full Name
  • Endothelial cell adhesion molecule
  • Introduction
  • Can mediate aggregation most likely through a homophilic molecular interaction.
  • Alternative Names
  • W117m; endothelial cell-selective adhesion molecule; 2310008D05Rik; HUEL (C4orf1)-interacting protein; LP4791 protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us