Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human F3 (Coagulation factor III, tissue factor) (CAT#: MP0033F)

The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • F3
  • Protein Length
  • Full Length
  • Protein Class
  • Enzyme
  • Molecular Weight
  • 33 kDa
  • TMD
  • 1
  • Sequence
  • METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
    PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
    AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
    KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
    CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS

Product Description

  • Activity
  • Yes
  • Application
  • in vitro diagnostic
  • Expression Systems
  • Cell-free expression system
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Proteoliposome
  • Purification
  • Sucrose gradient
  • Purity
  • >75% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • F3
  • Full Name
  • Coagulation factor III, tissue factor
  • Introduction
  • This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • TF, TFA, CD142

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us