Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FASLG (Fas ligand) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (103-281aa) (CAT#: MPX4539K)

This product is a 24.4kDa Human FASLG membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FASLG
  • Protein Length
  • Partial (103-281aa)
  • Protein Class
  • Transcription
  • Molecular Weight
  • 24.4kDa
  • TMD
  • 1
  • Sequence
  • QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • FASLG
  • Full Name
  • Fas ligand
  • Introduction
  • This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described.
  • Alternative Names
  • FASLG; APTL; FASL; CD178; CD95L; ALPS1B; CD95-L; TNFSF6; TNLG1A; APT1LG1; tumor necrosis factor ligand superfamily member 6; CD95 ligand; Fas ligand (TNF superfamily, member 6); apoptosis (APO-1) antigen ligand 1; apoptosis antigen ligand; fas antigen ligand; mutant tumor necrosis factor family member 6; tumor necrosis factor ligand 1A; Fas ligand

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us