Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADTRP (Androgen dependent TFPI regulating protein) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0908K)

This product is a Human ADTRP membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADTRP
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 31.8 kDa
  • TMD
  • 6
  • Sequence
  • MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Nanodisc
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ADTRP
  • Full Name
  • Androgen dependent TFPI regulating protein
  • Alternative Names
  • ADTRP; AIG1L; C6orf105; dJ413H6.1; androgen-dependent TFPI-regulating protein; FAHFA hydrolase ADTRP; androgen-dependent TPF1-regulating protein; fatty acid esters of hydroxy fatty acids hydrolase ADTRP; Androgen dependent TFPI regulating protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us