Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCER1G (Fc fragment of IgE receptor Ig) Full Length (CAT#: MPC2183K) Made to Order

This product is a 9.6 kDa Human FCER1G membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCER1G
  • Protein Length
  • Full length
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 9.6 kDa
  • TMD
  • 1
  • Sequence
  • MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV
    RKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • FCER1G
  • Full Name
  • Fc fragment of IgE receptor Ig
  • Introduction
  • The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors.
  • Alternative Names
  • FCER1G; FCRG; high affinity immunoglobulin epsilon receptor subunit gamma; Fc epsilon receptor Ig; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; Fc receptor gamma-chain; fc-epsilon RI-gamma; fcRgamma; fceRI gamma; immunoglobulin E receptor, high affinity, gamma chain; Fc fragment of IgE receptor Ig

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us