Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCER2 (Fc fragment of IgE receptor II) expressed in Sf9 for Antibody Discovery (CAT#: MP0102Q)

This product is a 31 kDa Human FCER2 membrane protein expressed in Sf9. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCER2
  • Protein Length
  • Partial
  • Protein Class
  • Secreted Protein, Transmembrane
  • Molecular Weight
  • 31 kDa
  • TMD
  • 1
  • Sequence
  • MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Product Description

  • Expression Systems
  • Sf9
  • Tag
  • C-DDK
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 50mM Tris-HCl pH8.0, 150mM NaCl, 10%glycerol

Target

  • Target Protein
  • FCER2
  • Full Name
  • Fc fragment of IgE receptor II
  • Introduction
  • The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
  • Alternative Names
  • BLAST-2; CD23; CD23A; CLEC4J; FCE2; IGEBF; low affinity immunoglobulin epsilon Fc receptor; C-type lectin domain family 4, member J; CD23 antigen; Fc epsilon receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); fc-epsilon-RII; immunoglobulin E-binding factor; immunoglobulin epsilon-chain; lymphocyte IgE receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us