Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCGR1A (Fc fragment of IgG receptor Ia) Expressed in NS0 for Antibody Discovery, Partial (16-288aa) (CAT#: MPX0405K)

This product is a 31.4 kDa Human FCGR1A membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGR1A
  • Protein Length
  • Partial (16-288aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 31.4 kDa
  • TMD
  • 1
  • Sequence
  • QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPG
    SSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEI
    HRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWN
    SNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTS
    PLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTA
    RREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FCGR1A
  • Full Name
  • Fc fragment of IgG receptor Ia
  • Introduction
  • This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1.
  • Alternative Names
  • FCGR1A; CD64; FCRI; CD64A; IGFR1; high affinity immunoglobulin gamma Fc receptor I; Fc fragment of IgG, high affinity Ia, receptor (CD64); Fc fragment of IgG, high affinity Ia, receptor for (CD64); Fc gamma receptor Ia; Fc-gamma RI; Fc-gamma receptor I A1; IgG Fc receptor I; fc-gamma RIA; fcgammaRIa; Fc fragment of IgG receptor Ia

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us