Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCRL2 (Fc receptor like 2) Expressed in NS0 for Antibody Discovery, Partial (20-395aa) (CAT#: MPX0328K)

This product is a 41.9 kDa Human FCRL2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCRL2
  • Protein Length
  • Partial (20-395aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 41.9 kDa
  • TMD
  • 1
  • Sequence
  • LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMA
    YHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKI
    KVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQ
    VLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRI
    PISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGK
    KTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRP
    VLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGG
    GASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FCRL2
  • Full Name
  • Fc receptor like 2
  • Introduction
  • This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
  • Alternative Names
  • FCRL2; FCRH2; IFGP4; IRTA4; SPAP1; CD307b; SPAP1A; SPAP1B; SPAP1C; Fc receptor-like protein 2; IFGP family protein 4; SH2 domain containing phosphatase anchor protein 1; fc receptor homolog 2; immune receptor translocation-associated protein 4; immunoglobulin receptor translocation-associated protein 4; immunoglobulin superfamily Fc receptor, gp42; Fc receptor like 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us