Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCGRT (Fc fragment of IgG receptor and transporter) Expressed in Mammalian cell expression system with 6xHis tag at the N-terminus for Antibody Discovery, Partial (24-297aa) (CAT#: MPX4256K)

This product is a 34.4kDa Human FCGRT membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCGRT
  • Protein Length
  • Partial (24-297aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 34.4kDa
  • TMD
  • 1
  • Sequence
  • AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • FCGRT
  • Full Name
  • Fc fragment of IgG receptor and transporter
  • Introduction
  • This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • FCGRT; FCRN; alpha-chain; IgG receptor FcRn large subunit p51; Fc fragment of IgG, receptor, transporter, alpha; FcRn alpha chain; IgG Fc fragment receptor transporter alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor; Fc fragment of IgG receptor and transporter

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us