Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCRL1 (Fc receptor like 1) Expressed in NS0 for Antibody Discovery, Partial (17-303aa) (CAT#: MPX0418K)

This product is a 32 kDa Human FCRL1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCRL1
  • Protein Length
  • Partial (17-303aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 32 kDa
  • TMD
  • 1
  • Sequence
  • AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF
    QFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRR
    SQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKG
    AVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSIT
    VRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLG
    SRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGA
    RSN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS and EDTA.

Target

  • Target Protein
  • FCRL1
  • Full Name
  • Fc receptor like 1
  • Introduction
  • This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains three extracellular C2-like immunoglobulin domains, a transmembrane domain and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs. This protein may play a role in the regulation of cancer cell growth. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • FCRL1; FCRH1; IFGP1; IRTA5; CD307a; Fc receptor-like protein 1; IFGP family protein 1; fc receptor homolog 1; fcR-like protein 1; hIFGP1; immune receptor translocation-associated protein 5; immunoglobulin superfamily Fc receptor, gp42; Fc receptor like 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us