Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCRL6 (Fc receptor like 6) Expressed in Mammalian cell expression system with 10xHis tag at the N-terminus for Antibody Discovery, Partial (20-307aa) (CAT#: MPX4281K)

This product is a 35.2 kDa Human FCRL6 membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCRL6
  • Protein Length
  • Partial (20-307aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 35.2 kDa
  • TMD
  • 1
  • Sequence
  • LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • FCRL6
  • Full Name
  • Fc receptor like 6
  • Alternative Names
  • FCRL6; FcRH6; Fc receptor-like protein 6; Fc receptor-like protein 7; IFGP6; IgSF type I transmembrane receptor; fc receptor homolog 6; fcR-like protein 6; leukocyte receptor; Fc receptor like 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us