Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FCRL6 (Fc receptor like 6) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (20-307aa) (CAT#: MPX4413K)

This product is a 33.7kDa Human FCRL6 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FCRL6
  • Protein Length
  • Partial (20-307aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 33.7kDa
  • TMD
  • 1
  • Sequence
  • LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • FCRL6
  • Full Name
  • Fc receptor like 6
  • Alternative Names
  • FCRL6; FcRH6; Fc receptor-like protein 6; Fc receptor-like protein 7; IFGP6; IgSF type I transmembrane receptor; fc receptor homolog 6; fcR-like protein 6; leukocyte receptor; Fc receptor like 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us