Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FLT3LG (Fms related receptor tyrosine kinase 3 ligand) Expressed in E.coli for Antibody Discovery, Partial (27-181aa) (CAT#: MPX0722K)

This product is a 18 kDa Human FLT3LG membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FLT3LG
  • Protein Length
  • Partial (27-181aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 18 kDa
  • TMD
  • 1
  • Sequence
  • TQDCSFQHSPISSDFAVKIRELSD
    YLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLER
    VNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNF
    SRCLELQCQPDSSTLPPPWSPRPLEATAPTA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • E.coli
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100-500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FLT3LG
  • Full Name
  • Fms related receptor tyrosine kinase 3 ligand
  • Introduction
  • Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts.
  • Alternative Names
  • FLT3LG; FL; FLG3L; FLT3L; fms-related tyrosine kinase 3 ligand; flt3 ligand; Fms related receptor tyrosine kinase 3 ligand

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us