Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF18 (TNF receptor superfamily member 18) Expressed in CHO for Antibody Discovery, Partial (26-161aa) (CAT#: MPX0283K)

This product is a 43 kDa Human TNFRSF18 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF18
  • Protein Length
  • Partial (26-161aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 43 kDa
  • TMD
  • 1
  • Sequence
  • QRPTGGPGCGPGRLLLGTGTDARCC
    RVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGV
    QSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHN
    AVCVPGSPPAE

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc and Avi tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • TNFRSF18
  • Full Name
  • TNF receptor superfamily member 18
  • Introduction
  • This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
  • Alternative Names
  • TNFRSF18; AITR; GITR; CD357; GITR-D; ENERGEN; tumor necrosis factor receptor superfamily member 18; TNF receptor superfamily activation-inducible protein; activation-inducible TNFR family receptor; glucocorticoid-induced TNFR-related protein; TNF receptor superfamily member 18

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us