Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FPR2 (Formyl peptide receptor 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3425K)

This product is a Human FPR2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FPR2
  • Protein Length
  • Full Length
  • Protein Class
  • GPCR
  • TMD
  • 7
  • Sequence
  • METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FPR2
  • Full Name
  • Formyl peptide receptor 2
  • Alternative Names
  • FPR2; ALX; ALXR; HM63; FMLPX; FPR2A; FPRH1; FPRH2; FPRL1; LXA4R; FMLP-R-II; N-formyl peptide receptor 2; FMLP-R-I; FMLP-related receptor I; LXA4 receptor; RFP; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related); Formyl peptide receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us