Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FXYD4 (FXYD domain containing ion transport regulator 4) Full Length (CAT#: MPC0505K) Made to Order

This product is a 9.3 kDa Human FXYD4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FXYD4
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 9.3 kDa
  • TMD
  • 1
  • Sequence
  • MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAI
    AGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTC

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • FXYD4
  • Full Name
  • FXYD domain containing ion transport regulator 4
  • Introduction
  • This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found.
  • Alternative Names
  • CHIF; FXYD domain-containing ion transport regulator 4; channel-inducing factor; FXYD4; FXYD domain containing ion transport regulator 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us