Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD10 (Frizzled class receptor 10) Expressed in NS0 for Antibody Discovery, Partial (21-161aa) (CAT#: MPX0031K)

This product is a 43 kDa Human FZD10 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD10
  • Protein Length
  • Partial (21-161aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 43 kDa
  • TMD
  • 7
  • Sequence
  • ISSMDMERPGDGKCQPIEIPMCKDIGYNMT
    RMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVS
    TPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEA
    PNNGSDEPTRG

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FZD10
  • Full Name
  • Frizzled class receptor 10
  • Introduction
  • This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
  • Alternative Names
  • Fz10; FzE7; CD350; FZ-10; hFz10; frizzled-10; frizzled 10, seven transmembrane spanning receptor; frizzled family receptor 10; frizzled homolog 10; FZD10; Frizzled class receptor 10

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us