Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD2 (Frizzled class receptor 2) Expressed in NS0 for Antibody Discovery, Partial (29-168aa) (CAT#: MPX0025K)

This product is a 42.3 kDa Human FZD2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD2
  • Protein Length
  • Partial (29-168aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 42.3 kDa
  • TMD
  • 7
  • Sequence
  • KGISIPDHGFCQPISIPLCTDI
    AYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC
    TVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQIC
    VGQNHSEDGAPALLTTAP

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FZD2
  • Full Name
  • Frizzled class receptor 2
  • Introduction
  • This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways.
  • Alternative Names
  • Fz2; fz-2; fzE2; hFz2; OMOD2; frizzled-2; frizzled 2, seven transmembrane spanning receptor; frizzled family receptor 2; frizzled homolog 2; FZD2; Frizzled class receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us