Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD7 (Frizzled class receptor 7) Expressed in CHO for Antibody Discovery, Partial (33-185aa) (CAT#: MPX0028K)

This product is a 43.3 kDa Human FZD7 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD7
  • Protein Length
  • Partial (33-185aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 43.3 kDa
  • TMD
  • 7
  • Sequence
  • QPYHGEKGISVPDHGFCQ
    PISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRF
    FLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCEN
    FPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in PBS
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FZD7
  • Full Name
  • Frizzled class receptor 7
  • Introduction
  • Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
  • Alternative Names
  • FzE3; frizzled-7; Frizzled, drosophila, homolog of, 7; frizzled 7, seven transmembrane spanning receptor; frizzled family receptor 7; frizzled homolog 7; fz-7; hFz7; FZD7; Frizzled class receptor 7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us