Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD8 (Frizzled class receptor 8) Expressed in CHO for Antibody Discovery, Partial (25-172aa) (CAT#: MPX0029K)

This product is a 43.3 kDa Human FZD8 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD8
  • Protein Length
  • Partial (25-172aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 43.3 kDa
  • TMD
  • 7
  • Sequence
  • AAAASAKELACQEITVPLCKGIGYNY
    TYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDY
    KKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMD
    YNRTDLTTAAPSPPRRLPPPPP

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FZD8
  • Full Name
  • Frizzled class receptor 8
  • Introduction
  • This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This gene is highly expressed in two human cancer cell lines, indicating that it may play a role in several types of cancer. The crystal structure of the extracellular cysteine-rich domain of a similar mouse protein has been determined.
  • Alternative Names
  • frizzled 8, seven transmembrane spanning receptor; frizzled family receptor 8; frizzled homolog 8FZ-8; hFZ8; frizzled-8; FZD8; Frizzled class receptor 8

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us