Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GALR2 (Galanin receptor 2) Full Length (CAT#: MPC0109K) Made to Order

This product is a 41.7 kDa Human GALR2 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GALR2
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41.7 kDa
  • TMD
  • 7
  • Sequence
  • MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVL
    LRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKA
    VHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIW
    GLSLLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDICTFVFSYLLPV
    LVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWM
    PHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
    KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAG
    ALRPCPGASQPCILEPCPGPSWQGPKAGDSILTVDVA

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • GALR2
  • Full Name
  • Galanin receptor 2
  • Introduction
  • Galanin is an important neuromodulator present in the brain, gastrointestinal system, and hypothalamopituitary axis. It is a 30-amino acid non-C-terminally amidated peptide that potently stimulates growth hormone secretion, inhibits cardiac vagal slowing of heart rate, abolishes sinus arrhythmia, and inhibits postprandial gastrointestinal motility. The actions of galanin are mediated through interaction with specific membrane receptors that are members of the 7-transmembrane family of G protein-coupled receptors. GALR2 interacts with the N-terminal residues of the galanin peptide. The primary signaling mechanism for GALR2 is through the phospholipase C/protein kinase C pathway (via Gq), in contrast to GALR1, which communicates its intracellular signal by inhibition of adenylyl cyclase through Gi. However, it has been demonstrated that GALR2 couples efficiently to both the Gq and Gi proteins to simultaneously activate 2 independent signal transduction pathways.
  • Alternative Names
  • GAL2-R; GALNR2; GALR-2; galanin receptor type 2; GALR2; Galanin receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us