Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GET1 (Guided entry of tail-anchored proteins factor 1) Full Length (CAT#: MPC4419K) Made to Order

This product is a made-to-order Human GET1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GET1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMR
    AEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKI
    KWVISVAFYVLQAALMISLIWKYYSVPVAVVPSKWITPLDRLVAFPTRVA
    GGVGITCWILVCNKVVAIVLHPFS

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • GET1
  • Full Name
  • Guided entry of tail-anchored proteins factor 1
  • Introduction
  • This gene is located in the candidate region for congenital heart disease (CHD) in Down syndrome (DS). It encodes a basic protein that functions as a receptor that promotes insertion of tail-anchored proteins in the endoplasmic reticulum membrane. This gene is located at a maternally-methylated differentially methylated region (DMR); however, its transcription may be biallelic, not imprinted. Alternative splicing results in different transcript variants. A pseudogene has been defined on chromosome 4.
  • Alternative Names
  • GET1; WRB; CHD5; guided entry of tail-anchored proteins factor 1; congenital heart disease 5 protein; tail-anchored protein insertion receptor WRB; tryptophan rich basic protein; Guided entry of tail-anchored proteins factor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us