Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GNRHR2 (Gonadotropin releasing hormone receptor 2 (pseudogene)) Full Length (CAT#: MPC0114K) Made to Order

This product is a 32.5 kDa Human GNRHR2 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GNRHR2
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 32.5 kDa
  • TMD
  • 7
  • Sequence
  • MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLD
    RQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQ
    CVTKGSFKAQWQETTYNLFTFCCLFLLPLTAMAICYSRIVLSVSRPQTRK
    GSHAPAGEFALPRSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWY
    WFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSID
    SSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • GNRHR2
  • Full Name
  • Gonadotropin releasing hormone receptor 2 (pseudogene)
  • Introduction
  • In non-hominoid primates and non-mammalian vertebrates, the gonadotropin releasing hormone 2 receptor gene (GnRHR2) encodes a seven-transmembrane G-protein coupled receptor. However, in human, the corresponding reading frame contains a premature stop codon, which has been suggested to encode a selenocysteine residue, but there is no solid evidence for selenocysteine incorporation (PMID: 12538601). It appears that the human GnRHR2 transcription occurs but the gene does not likely produce a functional multi-transmembrane protein. A non-transcribed pseudogene of GnRHR2 is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • GnRH-II-R; GnRH receptor II 5TM; Type II GnRH receptor; gonadotropin-releasing hormone (type 2) receptor 2, pseudogene; GNRHR2; Gonadotropin releasing hormone receptor 2 (pseudogene)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us