Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GOSR1 (Golgi SNAP receptor complex member 1) Full Length (CAT#: MPC4288K) Made to Order

This product is a made-to-order Human GOSR1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GOSR1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRY
    SSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSL
    NAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYK
    SGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKS
    IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • GOSR1
  • Full Name
  • Golgi SNAP receptor complex member 1
  • Introduction
  • This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
  • Alternative Names
  • GOSR1; P28; GS28; GOS28; GOLIM2; GOS-28; GOS28/P28; Golgi SNAP receptor complex member 1; 28 kDa Golgi SNARE protein; 28 kDa cis-Golgi SNARE p28; Golgi SNARE 28 kDa; cis-golgi SNARE; golgi integral membrane protein 2; Golgi SNAP receptor complex member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us