Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GP1BA (Glycoprotein Ib platelet subunit alpha) Expressed in NS0 for Antibody Discovery, Partial (17-505aa) (CAT#: MPX0450K)

This product is a 54.7 kDa Human GP1BA membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GP1BA
  • Protein Length
  • Partial (17-505aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 54.7 kDa
  • TMD
  • 1
  • Sequence
  • HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTT
    ILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDL
    SHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGN
    ELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSL
    YTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGV
    DVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT
    EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTK
    EQTTFPPRWTPNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMT
    TLEPTPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTP
    EPTPIPTIATSPTILVSATSLITPKSTFLTTTKPVSLLESTKKTIPELDQ
    PPKLR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • GP1BA
  • Full Name
  • Glycoprotein Ib platelet subunit alpha
  • Introduction
  • Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that is linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. This gene encodes the alpha subunit. Mutations in this gene result in Bernard-Soulier syndromes and platelet-type von Willebrand disease. The coding region of this gene is known to contain a polymophic variable number tandem repeat (VNTR) domain that is associated with susceptibility to nonarteritic anterior ischemic optic neuropathy.
  • Alternative Names
  • GP1BA; BSS; GP1B; VWDP; CD42B; GPIbA; BDPLT1; BDPLT3; DBPLT3; GPIbalpha; CD42b-alpha; platelet glycoprotein Ib alpha chain; GP-Ib alpha; antigen CD42b-alpha; glycoprotein Ib (platelet), alpha polypeptide; glycoprotein Ib platelet alpha subunit; mutant platelet membrane glycoprotein Ib-alpha; platelet membrane glycoprotein 1b-alpha subunit; platelet membrane glycoprotein Ib-alpha; Glycoprotein Ib platelet subunit alpha

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us