Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KLRC2 (Killer cell lectin like receptor C2) Full Length (CAT#: MPC2242K) Made to Order

This product is a 26 kDa Human KLRC2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRC2
  • Protein Length
  • Full length
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 26 kDa
  • TMD
  • 1
  • Sequence
  • MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSL
    NHQGIDKIYDCQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQN
    NSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNS
    SLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSD
    NAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KLRC2
  • Full Name
  • Killer cell lectin like receptor C2
  • Introduction
  • Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The group, designated KLRC (NKG2) are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The KLRC (NKG2) gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. KLRC2 alternative splice variants have been described but their full-length nature has not been determined.
  • Alternative Names
  • KLRC2; NKG2C; CD159c; NKG2-C; NKG2-C type II integral membrane protein; CD159 antigen-like family member C; NK cell receptor C; NKG2-C-activating NK receptor; killer cell lectin-like receptor subfamily C, member 2; natural killer cell receptor G2-C; Killer cell lectin like receptor C2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us