Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GPIHBP1 (Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX1238K)

This product is a Human GPIHBP1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPIHBP1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • Sequence
  • QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • GPIHBP1
  • Full Name
  • Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
  • Introduction
  • This gene encodes a capillary endothelial cell protein that facilitates the lipolytic processing of triglyceride-rich lipoproteins. The encoded protein is a glycosylphosphatidylinositol-anchored protein that is a member of the lymphocyte antigen 6 (Ly6) family. This protein plays a major role in transporting lipoprotein lipase (LPL) from the subendothelial spaces to the capillary lumen. Mutations in this gene are the cause of hyperlipoproteinemia, type 1D. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • GPIHBP1; HYPL1D; GPI-HBP1; GPI anchored high density lipoprotein binding protein 1; GPI-anchored HDL-binding protein 1; endothelial cell LPL transporter; Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us