Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GPR161 (G protein-coupled receptor 161) Expressed in Wheat germ for Antibody Discovery, Partial (362-460aa) (CAT#: MPX0035K)

This product is a 40 kDa Human GPR161 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GPR161
  • Protein Length
  • Partial (362-460aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 40 kDa
  • TMD
  • 7
  • Sequence
  • SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.1 EU/μg by the LAL method

Target

  • Target Protein
  • GPR161
  • Full Name
  • G protein-coupled receptor 161
  • Introduction
  • The protein encoded by this gene is an orphan G protein-coupled receptor whose ligand is unknown. This gene is overexpressed in triple-negative breast cancer, and disruption of this gene slows the proliferation of basal breast cancer cells. Therefore, this gene is a potential drug target for triple-negative breast cancer.
  • Alternative Names
  • RE2; G-protein coupled receptor 161; G-protein coupled receptor RE2; GPR161; G protein-coupled receptor 161

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us