Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GRM2 (Glutamate metabotropic receptor 2) for Antibody Discovery, Partial (20-498aa) (CAT#: MPX0041K)

This product is a 54 kDa Human GRM2 membrane protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GRM2
  • Protein Length
  • Partial (20-498aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 54 kDa
  • TMD
  • 7
  • Sequence
  • GPAKKVLTLEGDLVLGGLFPVHQKGGPAEDC
    GPVNEHRGIQRLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKDTHALE
    QALDFVRASLSRGADGSRHICPDGSYATHGDAPTAITGVIGGSYSDVSIQ
    VANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFFQAKAMAEILR
    FFNWTYVSTVASEGDYGETGIEAFELEARARNICVATSEKVGRAMSRAAF
    EGVVRALLQKPSARVAVLFTRSEDARELLAASQRLNASFTWVASDGWGAL
    ESVVAGSEGAAEGAITIELASYPISDFASYFQSLDPWNNSRNPWFREFWE
    QRFRCSFRQRDCAAHSLRAVPFEQESKIMFVVNAVYAMAHALHNMHRALC
    PNTTRLCDAMRPVNGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGI
    GRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLPAS

Product Description

  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS and DTT.

Target

  • Target Protein
  • GRM2
  • Full Name
  • Glutamate metabotropic receptor 2
  • Introduction
  • L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Several transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • GLUR2; mGlu2; GPRC1B; MGLUR2; glutamate receptor homolog; glutamate receptor, metabotropic 2; GRM2; Glutamate metabotropic receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us