Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GYPC (Glycophorin C (Gerbich blood group)) Full Length (CAT#: MPC3541K) Made to Order

This product is a made-to-order Human GYPC membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GYPC
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRME
    TSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTE
    FAESADAALQGDPALQDAGDSSRKEYFI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • GYPC
  • Full Name
  • Glycophorin C (Gerbich blood group)
  • Introduction
  • Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. Alternate splicing results in multiple transcript variants.
  • Alternative Names
  • GYPC; GE; GPC; GPD; GYPD; CD236; PAS-2; CD236R; PAS-2'; glycophorin-C; Gerbich blood group antigen; glycoconnectin; glycophorin-D; glycoprotein beta; sialoglycoprotein D; Glycophorin C (Gerbich blood group)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us