Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HCRTR1 (Hypocretin receptor 1) Expressed in Yeast with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Full Length (CAT#: MPX4316K)

This product is a 21.4 kDa Human HCRTR1 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HCRTR1
  • Protein Length
  • Full Length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 21.4 kDa
  • TMD
  • 7
  • Sequence
  • MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • HCRTR1
  • Full Name
  • Hypocretin receptor 1
  • Introduction
  • The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B.
  • Alternative Names
  • OX1R; orexin receptor type 1; hypocretin (orexin) receptor 1; hypocretin receptor type 1; orexin receptor 1; HCRTR1; Hypocretin receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us