Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HMOX1 (Heme oxygenase 1) expressed in E. coli for Antibody Discovery (CAT#: MP0017Q)

This product is a 31.4 kDa Human HMOX1 membrane protein expressed in E. col. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HMOX1
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Transmembrane
  • Molecular Weight
  • 31.4 kDa
  • Sequence
  • MERPQPHSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGD LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLEHHHHHH

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Endotoxin
  • < 1.0 EU per 1 microgram of protein
  • Purification
  • Conventional chromatography
  • Purity
  • >95% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH 8.0) containing 50mM NaCl, 0.1mM PMSF, 10% glycerol

Target

  • Target Protein
  • HMOX1
  • Full Name
  • Heme oxygenase 1
  • Introduction
  • Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.
  • Alternative Names
  • BK286B10; HMOX1D; HO-1; HSP32; heme oxygenase 1; heat shock protein, 32 kD; heme oxygenase (decycling) 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us