Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IER3 (Immediate early response 3) Full Length (CAT#: MPC2100K) Made to Order

This product is a 16.9 kDa Human IER3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IER3
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 16.9 kDa
  • TMD
  • 1
  • Sequence
  • MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAG
    RPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILM
    AEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQ
    QHPAAF

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • IER3
  • Full Name
  • Immediate early response 3
  • Introduction
  • This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not generate a valid protein.
  • Alternative Names
  • IER3; DIF2; IEX1; PRG1; DIF-2; GLY96; IEX-1; IEX-1L; radiation-inducible immediate-early gene IEX-1; PACAP-responsive gene 1 protein; anti-death protein; differentiation-dependent gene 2 protein; expressed in pancreatic carcinoma; gly96, mouse, homolog of; immediate early protein GLY96; immediate early response 3 protein; immediately early gene X-1; protein DIF-2; Immediate early response 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us