Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IFITM1 (Interferon induced transmembrane protein 1) Expressed in Wheat germ, Full Length (CAT#: MPX0083K)

This product is a 39 kDa Human IFITM1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IFITM1
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • Molecular Weight
  • 39 kDa
  • TMD
  • 2
  • Sequence
  • MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Product Description

  • Expression Systems
  • Wheat germ
  • Protein Format
  • Soluble
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • IFITM1
  • Full Name
  • Interferon induced transmembrane protein 1
  • Alternative Names
  • IFITM1; 9-27; CD225; IFI17; LEU13; DSPA2a; interferon-induced transmembrane protein 1; dispanin subfamily A member 2a; interferon-induced protein 17; interferon-inducible protein 9-27; leu-13 antigen; Interferon induced transmembrane protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us