Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human IFITM3 (Interferon induced transmembrane protein 3) Full Length (CAT#: MPC1198K) Made to Order

This product is a 14.6 kDa Human IFITM3 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • IFITM3
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • Molecular Weight
  • 14.6 kDa
  • TMD
  • 2
  • Sequence
  • MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRS
    ETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYA
    STAKCLNIWALILGILMTILLIVIPVLIFQAYG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • IFITM3
  • Full Name
  • Interferon induced transmembrane protein 3
  • Introduction
  • The protein encoded by this gene is an interferon-induced membrane protein that helps confer immunity to influenza A H1N1 virus, West Nile virus, and dengue virus. Two transcript variants, only one of them protein-coding, have been found for this gene. Another variant encoding an N-terminally truncated isoform has been reported, but the full-length nature of this variant has not been determined.
  • Alternative Names
  • IFITM3; 1-8U; IP15; DSPA2b; interferon-induced transmembrane protein 3; dispanin subfamily A member 2b; interferon-inducible protein 1-8U; Interferon induced transmembrane protein 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us